TABLE 2

Conservancy analysis of predicted human B cell epitopes in silico along the DENV2 NS5 amino acid sequence

Sequence of predicted epitopeaEpitope length (aa)b% (fraction) of protein sequence matches at identity ≥60%cMinimum identity (%)dMaximum identity (%)e
GTGNIGETLGEK12100.00 (18/18)83.33100.00
GIKRGETDHHAVSR1472.22 (13/18)50.00100.00
GLTKGGPGHEEPIPMS16100.00 (18/18)81.25100.00
GESSPSPTVEAG12100.00 (18/18)66.67100.00
KATYEPDVDLGSGTRNIGIESETPNL2650.00 (9/18)53.85100.00
KQEHETSWHYDQDHPYKTWAYHGSYETKQTGSASS35100.00 (18/18)68.57100.00
VDTRTQEPKEGTK1388.89 (16/18)53.85100.00
SKKEGGAMYADDTAGWD17100.00 (18/18)70.59100.00
IQQWEPSRGWNDW13100.00 (18/18)69.23100.00
PWMEDKTPVESWEE14100.00 (18/18)64.29100.00
  • a Human B cell epitopes were predicted in silico along the DENV2 JHA1 NS5 amino acid sequence using the Bepipred linear epitope prediction method (45). Predicted epitopes with higher scores (cutoff of 1.0 for each amino acid) were selected for conservancy analysis.

  • b Length of predicted epitopes, in amino acids (aa).

  • c The conservancy of human B cell epitopes predicted in DENV2 NS5 was compared among the four serotypes of DENV, using four samples of NS5 amino acid sequences representative of DENV1 and DENV3 and five representatives of DENV2 and DENV4. The minimum identity for selection was set to ≥60%. Numbers of protein sequences matching a minimal identity of 60% with DENV2 JHA1 strain NS5 protein are given as percent and as fraction. Conservancy analysis was carried out using the epitope conservance analysis method of the Immune Epitope Database and Analysis Resource (46).

  • d Minimum identity found for each epitope predicted for the DENV2 JHA1 NS5 protein compared to its counterparts found in NS5 amino acid sequences from other DENV strains or serotypes.

  • e Maximum identity found for each epitope predicted for the DENV2 JHA1 NS5 protein compared to its counterparts found in NS5 amino acid sequences from other DENV strains or serotypes.