TABLE 3

Peptides with cross-reactivity among Chlamydia species

PeptideSequence (5′–3′)ELISA signal with Chlamydia monospecific antisera ([RLU/s] × 10−3)aNo. of sequence variants/total sequences of reactive speciesbNo. of peptides/species detectionc
CabCpsCcaCfeCpeCpnCmuCsuCtr
Cab_S26/3_OmpA_089-104PTGTAAANYKTPTDRP23000022000Cab (2/49), Cpn (2/36)1, 1
Cab_S26/3_OmpA_223-262NVVSSPAQFVVHKPRGYKGTAFPLPLTAGTDQATDTKSAT0000039101Cpn (3/37)*1
Cab_S26/3_OmpA_309-324AVLNLTTWNPTLLGEA5746066100113Cab (1/38), Cps (14/132), Cpn (2/39)1, 4, 1, 3
Cab_S26/3_OmpA_302-341AQPKLAAAVLNLTTWNPTLLGEATALDTSNKFADFLQIAS178915061170089Cab (2/38), Cps (20/209), Cca (1/5), Cpn (2/39)1, 7, 1, 1, 2
Cab_S26/3_OmpA_366-389KWSITGEARLINERAAHMNAQFRF0321000035740Cps (4/287), Csu (1/33), Cmu (1/13)1
Cab_S26/3_PmpD_1074-1113ESVKQPENKTLADINSIGIDLASFVSSDDETPVPPQIIVP1362694013400000Cab (1/8), Cps (3/76), Cca (1/3), Cfe (1/6)1, 1, 1, 1
Cca_GPIC_PmpD_571-610ITFSYNKGTILPFPKVAASSEGESAPEAPKESSPVDLGVR03191011000Cca (1/3)*1
Cfe_Fe/C_PmpD_569-598FSYNSGKFLPLPMPSAEVSEENSSQNAPVE00182000000Cca (1/3)*1
Cfe_Fe/C_PmpD_1083-1112EKTLADISSIGVDLASFVTNDDGSSPLPPQ11621415126001100Cab (1/8), Cps (3/76), Cca (1/3), Cfe (1/6)1, 1, 1, 1
Cpn_CWL029_PmpD_654-693EKSLNACSHGDHYPPKTVEEEVPPSLLEEHPVVSSTDIRG00020115000Cpn (1/16)*1
Cpe_E58_OmpA_313-328PIFNLTTWNPTLLGQA411405400087Cpn (2/39), Ctr (11/738)4
Csu_99DC3_OmpA_345-384RKSCGLAVGTTIVDADKYAVTVETRLIDERAAHVNAQFRF0267000036870Cps (1/287), Csu (1/33), Cmu (1/13)2, 1, 1
Csu_99DC3_PmpD_535-564NARAPQAVPTRDPEEVFSLSAESLNGCSGG0060800160Csu (2/2)*2
Ctr_D/UW-3_OmpA_041-056EGFGGDPCDPCATWCD02701610600Cps (4/284), Cfe (1/13)1, 1
Ctr_D/UW-3_OmpA_104-119RENPAYGRHMQDAEMF0000011920197Cpn (1/36), Ctr (4/741)1, 2
Ctr_D/UW-3_OmpA_080-119KEFQMGAKPTTDTGNSAAPSTLTARENPAYGRHMQDAEMF0000029490376Cpn (2/36), Ctr (24/763)1, 2, 16, 9
Ctr_D/UW-3_OmpA_152-181SFNLVGLFGDNENQKTVKAESVPNMSFDQS0500000097Ctr (28/601)12
Ctr_D/UW-3_OmpA_233-248EFTINKPKGYVGKEFP000000041100Csu (25/98), Ctr (8/750)10, 3
Ctr_D/UW-3_OmpA_245-260KEFPLDLTAGTDAATG00000000105Ctr (9/750)*4
Ctr_D/UW-3_OmpA_226-265NVLCNAAEFTINKPKGYVGKEFPLDLTAGTDAATGTKDAS000000024295Csu (28/98), Ctr (12/750)12, 4
  • a That is, the average reactivity of three repeats of each peptide in a high-stringency ELISA with background subtracted (P < 10−3; one-tailed Student t test).

  • b Sequence variants among all GenBank peptide sequence accession numbers for the reactive chlamydial species. *, despite experimental reactivity with only a single species, potential for cross-reactivity between species exists because of extensive shared peptide sequences.

  • c Number of variant peptides within the respective Chlamydia spp. required to provide Chlamydia species-specific antibody binding to ≥95% of all GenBank sequence accession numbers at ≤2-amino-acid mismatch tolerance.