TABLE 2

Highly reactive Chlamydia species-specific peptides

PeptideSequence (5′–3′)ELISA signal ([RLU/s] × 10−3)aNo. of sequence variants/total sequencesbPeptides/species detectioncARR cross-reactivityd
Cab_S26/3_OmpA_153-176NLVGLIGVKGSSIAADQLPNVGIT3652/391I
Cab_S26/3_PmpD_1060-1089KIESPTSNVYYSAHESVKQPENKTLADINS1852/71II
Cab_S26/3_IncA_324-353STAVTEHADIPRDPNRDPRGGRGGQSSPSV1092/51
Cps_02DC15_OmpA_158-181LVGLIGFSAASSISTDLPTQLPNV10630/2888*III
Cps_05DC15_OmpA_250-265ASSNFPLPITAGTTEA7817/2044*IV
Cps_02DC15_OmpA_333-348STTALPNNSGKDVLSD29920/2095*III
Cps_02DC15_IncA_321-360SLTSTTETADQGDLRDPSGDRYGGWGAQSSYRLSPSVTMS3287/774*V
Cps_02DC15_CT618_105-134YEVDSATGSFKIVTKNIQKPNGEVEIVSSR2493/412
Cps_02DC15_CT618_189-228CGAVDDVISIVSTLRSTDFDPSYEDLVQRRVTLREKFFSL3433/412
Cca_GPIC_OmpA_159-168VTGTDLQGQY1171/51
Cca_GPIC_IncA_316-355LIGVMVQDGAESSTVEEASQDDSAQPQDENQSDAGEHKDS3211/41
Cca_GPIC_CT618_134-163EVDAQTGNFVLQTKTVQLEDGTQRVVPSRV3831/31
Cca_GPIC_CT618_220-249ADDAVDIVSLVRSPTGDLSTEELSERRQTL1801/31
Cfe_Fe/C_OmpA_160-175IGLAGTDFANQRPNVE461/101
Cfe_Fe/C_PmpD_1055-1084PNVKSVEKIESPSAKSYYSNYEIEKNPIEK521/61
Cfe_Fe/C_CT618_108-137DSASGNFKIGVKSVKNENGETVLVPCRILK5281/31
Cpe_E58_OmpA_090-105TSPNNAADSSTTAERA4824/2038*
Cpe_E58_OmpA_161-176ISGSSLEGKYPNANIS6327/20910*
Cpe_E58_OmpA_323-338LGQATTVDGTNKFADS19827/21511*
Cpe_E58_IncA_281-300AAPAAPAAPAAPAAPA11014/1269*
Cpe_E58_IncA_311-326PAPENNDNNNDDNAAS5138/895
Cpe_E58_CT529_209-248IIRERRAYQRCLERLNQKEVGQEESGSAQEVQAMRSSYVK1542/151
Cpe_E58_CT442_151-190DGSNQIFVDSNRDIRRPGSGGSGGVSASGALEQVANIVMN943/193
Cpn_CWL029_PmpD_0147-0187EKISSDTKENRKDLETEDPSKKSGLKEVSSDLPKSPETAV801/161
Cpn_CWL029_PmpD_1131-1170NKEETLVSAGVQINMSSPTPNKDKAVDTPVLADIISITVD1161/161
Cpn_CWL029_IncA_331-370QKAESEFIACVRDRTFGRRETPPPTTPVVEGDESQEEDEG3402/132
Cpn_CWL029_CT618_201-216PETISDPENRNKPSAE2151/131
Cmu_Nigg_PmpD_724-739KVETADINSDKQEAEE201/61
Cmu_Nigg_PmpD_1038-1053EIGDLEDSVNSEKTPS501/61
Cmu_Nigg_CT618_190-205TKDKCCDSTQGNSFME411/51
Csu_99DC3_OmpA_166-181FGLTTTSVAAQDLPNV625/5522*
Csu_99DC3_OmpA_317-332TISGKGQDAQTLQDTM2020/4012*
Csu_99DC3_IncA_259-293LANIKEALIKPSRPPLPKNGFPRTMPPCPPRQTPP761/11
Csu_99DC3_CT529_207-236EERCNRILCGQADEVLGINNTMCEQFVRQR132/22
Ctr_D/UW-3_OmpA_082-105FQMGAKPTTDTGNSAAPSTLTARE16628/60111*
Ctr_D/UW-3_OmpA_159-174FGDNENQKTVKAESVP2022/74110*
Ctr_D/UW-3_OmpA_313-328IFDTTTLNPTIAGAGD53511/7383VI
Ctr_D/UW-3_OmpA_324-339AGAGDVKTGAEGQLGD7318/7256*
Ctr_D/UW-3_OmpA_306-345QPKSATAIFDTTTLNPTIAGAGDVKTGAEGQLGDTMQIVS58718/7258VI
Ctr_D/UW-3_PmpD_536-565ARAPQALPTQEEFPLFSKKEGRPLSSGYSG33/2011
Ctr_D/UW-3_PmpD_1036-1065SGTPVQQGHAISKPEAEIESSSEPEGAHSL65/2023
Ctr_D/UW-3_CT529_200-239SAERADCEARCARIAREESLLEVPGEENACEKKVAGEKAK274/1822
Ctr_D/UW-3_IncG_108-147RPSDQQESGGRLSEESASPQASPTSSTFGLESALRSIGDS404/1832
  • a Background-corrected average signals of six repeats with homologous sera at high stringency are shown. The signal for all peptides was highly significantly above background (P < 10−5; one-tailed Student t test). The method has an interassay CV of 11.2% and an intra-assay CV of 8.5%. All peptides were nonreactive above background with nonhomologous mouse sera against the eight remaining chlamydial species.

  • b Sequence variants among all GenBank sequence accession numbers for the respective Chlamydia peptide sequences.

  • c That is, the number of variant peptides within the respective Chlamydia spp. required to provide Chlamydia species-specific antibody binding to ≥95% of all GenBank sequence accession numbers at a ≤2 amino acid mismatch tolerance. *, peptides from this ARR show serovar-specific reactivity.

  • d Potential for cross-reactivity of the antibody reactive peptide region (ARR) with other Chlamydia species/strains: I, Cps strains VS225 and GR9; II, Cps GR9 and possibly other Cps strains; III, Cab strains with Cps strains VS225 and GR9; IV, Cab strains with Cps strain VS225; V, ARR absent in Cps strain VS225, no reactivity; VI, central residues shared among all chlamydial species. Homologs from other species show unpredictable patterns of cross-reactivity.