TABLE 1

Peptide sequences containing immunodominant epitopes of OppA2

Peptide (amino acids comprising the peptide)Amino acid sequence
OppA (11-25)IFFLTFLCCNNKERK
OppA (191-225)YGQNWTNPENMVTSGPFKLKERIPNEKIVFEKNNK
OppA (276-290)SDYYSSAVNAIYFYS
OppA (276-300)SDYYSSAVNAIYFYSFNTHIKPLD
OppA (286-300)IYFYSFNTHIKPLD
OppA (286-310)IYFYSFNTHIKPLDNVKIRKALTLA
OppA (356-375)LAEAGYPNGNGFPILKLKYN
OppA (381-400)KKICEFIQNQWKKNLNIDVE
OppA (491-505)APIYIYGNSYLFRND