Table 1

Detailed structure of recombinant RV E1 fragment-containing proteinsa

Protein designationElements of the protein primary structure (from the N to the C terminus)
HBc vectorLeft spacerInserted RV E1 sequencebRight spacerHBc vectorC-terminal linker
HBcΔ-E1(214-285)1–79GGSGGQQSRWGLGSPNCHGPDWASPVCQRHSPDCSRLVGATPERPRLRLVDADDPLLRTAPGPGEVWVTPVIGSQARGGSGG78–144ISLGPGLEKLEFG
HBcΔ-E1(214-240)1–79GGSGGQQSRWGLGSPNCHGPDWASPVCQRHSPGGSGG78–144ISLGPGLEKLEFG
HBcΔ-E1(245-285)1–79GGSGGLVGATPERPRLRLVDADDPLLRTAPGPGEVWVTPVIGSQARGGSGG78–144ISLGPGLEKLEFG
  • a The RV E1(1-441) sequence is EEAFTYLCTAPGCATQAPVPVRLAGVRFESKIVDGGCFAPWDLEATGACICEIPTDVSCEGLGAWVPTAPCARIWNGTQRACTFWAVNAYSSGGYAQLASYFNPGGSYYKQYHPTACEVEPAFGHSDAACWGFPTDTVMSVFALASYVQHPHKTVRVKFHTETRTVWQLSVAGVSCNVTTEHPFCNTPHGQLEVQVPPDPGDLVEYIMNHTGNQQSRWGLGSPNCHGPDWASPVCQRHSPDCSRLVGATPERPRLRLVDADDPLLRTAPGPGEVWVTPVIGSQARKCGLHIRAGPYGHATVEMPEWIHAHTTSDPWHPPGPLGLKFKTVRPVALPRALAPPRNVRVTGCYQCGTPALVEGLAPGGGNCHLTVNGEDVGAFPPGKFVTAALLNTPPPYQVS CGGESDRASARVIDPAAQSFTGVVYGTHTTAVSETRQTWAE, where the RV E1 epitopes selected for insertion into HBc vectors are marked by bold (aa 214 to 285) and underlining (aa 214 to 240 and 245 to 285). HBcΔ is derived from the HBV320 genome, genotype D, subtype ayw (42).

  • b Cys residues within the inserted RV E1 sequences are in bold.