Previous Article | Next Article ![]()
Clinical and Vaccine Immunology, October 2006, p. 1104-1110, Vol. 13, No. 10
1071-412X/06/$08.00+0 doi:10.1128/CVI.00188-06
Copyright © 2006, American Society for Microbiology. All Rights Reserved.
Molecular Immunology and Vaccine Research Laboratory, Pasteur Institute of Iran, 69 Pasteur Ave., Tehran 13164, Iran,1 Infectious Disease Research Center, CHUL Research Center, CHUQ, and Department of Medical Biology, Faculty of Medicine, Laval University, 2705 Laurier Blvd., Quebec, Québec G1V 4G2, Canada2
Received 18 May 2006/ Returned for modification 7 July 2006/ Accepted 26 July 2006
|
|
|---|
|
|
|---|
At present, most diagnostic tools from PCR to antigen-based enzyme-linked immunosorbent assays (ELISAs) are not suitable for field conditions, and the diagnosis of VL still relies on bone marrow puncture (30). A better knowledge of Leishmania proteins should allow us to improve the diagnostic markers. The goal of the present study is to evaluate the serum reactivities of different stages of CL and VL cases to the conserved extracellular domain of newly identified surface antigens in Leishmania harboring the amastin signature sequence (29). Amastins belong to a large family of surface proteins that have recently been discovered in the genus Leishmania (21) and show high similarity to the amastin proteins in Trypanosoma cruzi. The members of the amastin gene family, approximately 45 in all, are dispersed all through the genome of Leishmania. Amastin genes usually code for small proteins of about 200 amino acids (aa) (21). Amastins are unique to kinetoplastids and are expressed specifically in the amastigote stage of the parasite (21, 29). Amastin gene expression is upregulated by a decrease in the pH (one of the properties of the intraphagolysosomal space). Due to its relative hydrophobic sequence and its localization in the membrane, it is believed that the amastin family plays a role in proton or ion traffic across the membrane to adjust the cytoplasmic pH. Nonetheless, the role of the amastin gene family in the virulence of Leishmania is still unclear (21). All members of the amastin gene family possess two predicted extracellular domains. The first domain, located between transmembrane helices 1 and 2, is 55 to 60 aa long and contains a highly conserved sequence of 11 aa at positions 52 to 62 that is present in all of the Leishmania and Trypanosoma amastin homologs and corresponds to the amastin signature sequence. This well-defined domain was not found in any other protein, which suggests that amastin surface proteins are probably unique to trypanosomatid protozoa. Although the putative function of the amastin signature sequence remains elusive, a recent report by Stober et al. showed that the N terminus of amastin proteins (aa 1 to 63) that harbors the 11-aa (CITLWGLKTDC) amastin signature sequence is highly immunogenic and induces protection in mice (27). In addition, Salotra et al. showed an upregulation of class III amastins (29) in post-kala-azar dermal leishmaniasis (PKDL) by comparing the PKDL with kala-azar parasites using microarrays (23). However, the role of amastin proteins in persistence and reactivation in PKDL remains to be characterized.
In the present study, we evaluated different stages of Iranian CL and VL antibody responses to the amastin signature peptide. In Iran, both zoonotic and anthroponotic CL caused by L. major and L. tropica, respectively, are endemic in different regions, especially in the cities of Esfahan and Mashhad. Kala-azar is another form of leishmaniasis which is endemic in Iran, with major foci in the northwest, south, and southwest. The causative agent is L. infantum and the main reservoir is infected dogs. The disease is more common among the rural population and children, aged 1 to 10 years, are the targets of disease. By using ELISA and Western blotting analyses, we show that the amastin signature peptide could be a valuable diagnostic tool for serodiagnosis of the active stage of visceral leishmaniasis.
|
|
|---|
Synthesis of the N-terminal domain of an L. major amastin member displaying conserved amino acid sequences with other L. major members and with one L. infantum amastin member. The amastin signature peptide of L. major LmjF08.0810 consisting of 52 amino acids with the sequence PIDMFRPHNTSRIGNTPCLTLWGYKSECYSTKYDVRSDDLWANCTDRLLQFR was selected for the present study. This sequence shares 48 to 100% homology to seven other L. major amastin homologs (LmjF08.0850, LmjF08.0800, LmjF08.0840, LmjF08.0830, LmjF08.0820, LmjF08.0970, and LmjF08.0960), as well as 53% homology to L. infantum (LinJ34.840). The amastin peptide was chemically synthesized (University of Lausanne, Lausanne, Switzerland) by solid-phase Fmoc (9-fluorenylmethoxy carbonyl) chemistry as described previously (22) and purified to homogeneity under the good laboratory practice condition. Amino acid analysis, analytical high-pressure liquid chromatography, and mass spectrometry were used to determine the purity of the final product. The purity has been analyzed by high-pressure liquid chromatography and been shown to be >95%.
Origin and collection of sera. All CL samples were collected from the city of Mashhad, in eastern Iran. The VL samples were collected from different villages around the Meshkinshahr area, northwest of Iran, where there have been no reports of CL. Three different groups were selected corresponding to active, recovered, and nonhealed CL cases. For the active CL group, 30 newly diagnosed patients with CL without prior treatment were chosen. Patients were subjected to parasitologic investigation and confirmed by parasite detection in the smear and/or NNN culture. All were negative for the leishmanin skin test (LST). The LST was carried out by interadermal injection of 0.1 ml of leishmanin (Pasteur Institute of Iran) (induration < 5 mm). Thirty recovered individuals with 100% positive LSTs (induration > 5 mm) and scarring were selected. The mean average after their healing is 3.2 ± 1.5 years. The nonhealed cases were selected among those who have had the active lesion for more than 3 years, and 30 individuals were selected (90% negative for LST). Three different groups of active, recovered, and asymptomatic individuals were selected, and 21 serum samples were obtained from active VL cases ranging in age from 1 to 3 years and were diagnosed by the detection of Giemsa-stained amastigotes in bone marrow aspirates and by clinical evaluation (fever, splenomegaly), together with an indirect immunofluorescence assay with whole parasites as the antigen. The recovered cases consisted of 10 individuals ranging from 5 to 15 years old. These subjects had been diagnosed with VL based on criteria similar to those for the active cases, and standard intravenous antimony treatments were applied. All had positive LST results. The third group consisted of asymptomatic individuals without any disease living in the same area and with a positive LST. Ten healthy individuals living in areas where leishmaniasis is not endemic and who had negative LST results were selected as a control group (normal cases).
Western blotting. Promastigote parasite antigens (3 x 108 promastigotes subjected to 10 cycles of alternate freeze-thawing) were obtained at a concentration of 1 mg/ml of total proteins (BCA Chemical, Rockford, Ill.). This preparation (2 µg/lane) or the amastin signature peptide (1 µg/lane) was subjected to sodium dodecyl sulfate-polyacrylamide gel electrophoresis on either 12 or 15% polyacrylamide in an equal volume of sample buffer (125 mM Tris-HCl [pH 6.8], 6% sodium dodecyl sulfate, 20% glycerol, 10% 2-mercaptoethanol, 0.05% bromophenol blue). The proteins were then transferred by Western blotting (Mini-Protean II; Bio-Rad) to a nitrocellulose membrane at 90 V for 1 h. The membrane was further treated with 1:100 dilutions of six active VL sera. Peroxidase conjugates of direct human poly antibody (poly Ab) (immunoglobulin M [IgM], IgG, and IgA) were used at a 1:1,000 dilution.
ELISA. Microtiter plates (Maxisorb plate; Nunc) were coated with freeze-thawed (F/T) parasite antigens of either L. major or L. infantum at concentrations of 10 µg/ml. The amastin signature synthetic peptide was used at concentration of 20 µg/ml. The plates were incubated overnight at 4°C and then blocked with 1x phosphate-buffered saline-1% bovine serum albumin at 37°C for 2 h to prevent nonspecific binding. Sera were added (1:50), followed by incubation for 2 h at 37°C. As a secondary antibody, horseradish peroxidase-labeled goat anti-human poly Ab (1:1,000) or biotin-labeled total IgG and its subclasses (total IgG at 1:3,000, IgG1 at 1:1,000, IgG2 at 1:2,000, IgG3 at 1:4,000, and IgG4 at 1:10,000 dilutions) were used with incubation at 37°C. The plates were washed three times and, in the cases of biotin-labeled antibodies, an extra step was taken for incubation with streptavidin-horseradish peroxidase (BRL, Gaithersburg, MD) for 1 h at room temperature. Binding of conjugates was visualized with O-phenylenediamine in 0.1 M sodium citrate (pH 4.5) containing 0.03% H2O2. The reaction was stopped by adding 4 M H2SO4, and the absorbance value was measured at 492 nm in an automatic micro-ELISA reader (Techan). The absorbance is expressed as the mean optical density at 492 nm ± the standard deviation (SD) in all groups. The cutoff value is determined as 5 SDs above the mean absorbance of normal sera.
Statistical analyses. All statistical analyses were carried out by using SPSS for Windows version 13.0 (SPSS, Inc., Chicago, Ill.). The differences were determined by one-way analysis of variance and/or by the general linear Tukey model, and they were considered statistically significant when the P value was <0.05.
|
|
|---|
|
View larger version (18K): [in a new window] |
FIG. 1. Sequence alignments of the N-terminal domain of four L. major amastin members and one L. infantum amastin member. The L. major amastin homologs present on chromosomes 8 and 34 (LmjF08.0800 and LmjF08.0820; four more identical copies, LmjF34.0960, and LmjF34.0970) and the L. infantum homolog LinJ34.0860 (previously reported as LinJ34.0860) (21) are shown in this alignment. The 11-aa amastin signature sequence is underlined. An asterisk means that amino acids are identical in all sequences shown in the alignment. A colon means that conserved substitutions are observed, and a period means that semiconserved substitutions are observed.
|
![]() View larger version (23K): [in a new window] |
FIG.2. Detection and concentration of amastin-binding antibodies in sera from patients with active VL. (A) Microtiter plates were coated with either 10 or 20 µg of L. infantum lysates or the amastin signature peptide/ml, respectively. Six sera of active VL cases were pooled, and serial dilutions were made. Anti-human peroxidase-conjugated antibody at a 1:1,000 dilution was used. The results are given as the mean optical density (O.D.) ± the SD at the indicated dilutions. (B and C) Western blotting analysis was performed by using 2 µg of amastin signature peptide and 1 µg of F/T lysates of L. infantum/lane and six sera samples (A to F) diluted to 1:100. Low-molecular-mass markers are indicated in kilodaltons on the left.
|
![]() View larger version (78K): [in a new window] |
FIG. 2 Continued.
|
![]() View larger version (15K): [in a new window] |
FIG. 3. Reactivity of sera from patients with CL and healthy controls with amastin signature peptide. An ELISA was performed with sera diluted 1:50 from all patients at different stages. The horizontal line represents cutoff values that were calculated by adding 5 SD values to the mean optical density (OD) of normal sera.
|
![]() View larger version (15K): [in a new window] |
FIG. 4. Reactivity of sera (total IgG) from patients with VL and healthy controls with amastin signature peptide. An ELISA was performed with sera diluted 1:50 from all patients at different stages. The horizontal line represents cutoff values that were calculated by adding 5 SD values to the mean optical density (OD) of normal sera.
|
|
View this table: [in a new window] |
TABLE 1. Percentage of serum reactivities toward amastin signature peptide in normal and VL cases
|
|
View this table: [in a new window] |
TABLE 2. Total IgG and IgG subclasses against amastin signature peptide in the sera isolated from VL patients and normal healthy individuals
|
|
|
|---|
In the present study, we used a highly pure 52-aa synthetic peptide corresponding to the first extracellular domain of Leishmania amastin surface proteins. This peptide contains a highly conserved sequence of 11 aa, which is present in all of the Leishmania and Trypanosoma amastin homologs and represents the amastin signature sequence (21). This well-defined domain was not found in any other protein in the databases, which suggests that the family of amastin surface proteins is probably unique to trypanosomatid protozoa. Since the expression of amastins is specific to the amastigote stage and this stage is associated with pathology in humans, we were interested in examining the antibody response against the highly pure amastin signature peptide. We showed that the amastin antibody response was specific for the active stage of VL patients. Using serial dilutions in the ELISA, we showed that the seroreactivity toward amastin peptide is similar to that obtained with the crude promastigote lysates (F/T antigen). By comparing different stages of VL, we showed that the amastin-reactive antibodies are present at high titers in 20 of 21 sera collected from patients with active VL (95% reactivity) and thus could be used as a stage-specific disease marker. This is an important finding since there are not too many antigens which could show stage specificity for VL. During the last few years, many purified and recombinant antigens, such as soluble leishmanial antigen (13), gp63 (25), H2A (26), KMP11 (18), rPSA (3), rCPB (20), rK39 (2), and A2 (5), have been used in serological tests. It has been reported that, during the acute phase of the VL disease, the host may produce specific antibodies, including the A2 and K39 antigens (15). Therefore, amastin is another antigen that acts similarly, and it would be possible to make a diagnostic kit consisting of these three antigens. Although the use of peptide or recombinant protein mixtures requires a rigorous standardization and close monitoring of the solid phase during the antigen adsorption step in order to warrant reproducible performance, the fusion of different antigenic peptides into a single stable molecule represents an interesting alternative that permits a uniform adsorption without the loss of the individual peptides.
In the present study, we also assessed the level of IgG subclasses toward amastin signature peptide and showed that IgG3 has the highest absorbance in all three stages. Although in our study there are no significant differences between the IgG3 level at different stages of VL patients, there are two other studies from Sudan and Brazil in which the researchers monitored each patient before and after treatment (7, 19). Elassad et al. determined IgG subclasses longitudinally in 28 VL patients before treatment and after 1 month of treatment with Pentostam. Those authors noted a significant decrease in antibody levels for subclasses IgG1 and IgG3 after treatment. This may be due to immune regulation at the helper cell level, and treatment might have lowered the parasite load and allowed the immune response to switch from a Th2 to Th1 cytokine response (7). In a study from Brazil, Pedras et al. showed that IgG subclass antibody detection constitutes a valuable alternative to increase the efficiency of the serological diagnosis of mucosal leishmaniasis. Those authors found that the anti-Leishmania braziliensis IgG3 is the first antibody that decreases in serum 90 days after treatment (19). IgG3 is one of the key components of Fc
R-mediated effector response (antibody-dependent cell-mediated cytotoxicity, immune phagocytosis) and can neutralize pathogens at their entry into the body (17). Fc
Rs are largely expressed by many cells, such as neutrophils, monocytes, macrophages, and NK cells (11). It has been shown that in malaria cases, IgG3, which represents a small percentage of total IgGs and has a significantly shorter half-life than other IgG subclasses, can be more efficient than IgG1 in clearing malaria infections, and it is more protective (9). Furthermore, it has recently been shown that IgG3 is more potent than other subclasses in neutralizing human immunodeficiency virus type 1 (24). Therefore, it is highly crucial to have the most appropriate secondary antibody response in infected individuals, since this type of response has the best chance of clearing the infection and/or controlling disease (10). This could be fundamental for vaccine strategies, and for this reason we consider amastin to be a good vaccine candidate against leishmaniasis, as has recently been suggested by the work of Stober et al. with mice (27).
In CL cases, the percentage of seroreactivity against the amastin signature region in active stage is only 20%, and it is not as strong as for VL active individuals. This may be due to pathophysiological differences that are present in these two different forms of leishmaniasis (15). The level of amastin antibody production is much higher in VL than in cutaneous forms of the disease. This could also be explained by differences in the expression of these amastin homologs between L. major and L. infantum. Our recent data suggest that there are important differences, at least at the mRNA expression levels, between several amastin homologs of L. major and L. infantum (21; unpublished data).
Overall, we show here for the first time that the amastin conserved signature sequence at the N-terminal extracellular domain is highly immunogenic in both CL and VL. Due to the unique feature of amastins, which are present only in trypanosomatids, the possibilities for a cross-reactivity with other common diseases, such as malaria and tuberculosis, in areas where Leishmania is endemic are almost nonexistent. The amastin signature sequence is an interesting target for further investigation of VL caused by L. donovani, especially the rare cases of PKDL. There is a recent report using microarrays showing that, among PKDL cases, there is specific upregulation of class III amastins (12). At present, we are focusing on L. donovani-infected individuals to further investigate the potential of amastin peptides as sensitive and stage-specific diagnostic tools against this fatal disease.
A.R. is the recipient of a Fonds de la Recherche en Santé du Québec doctoral award. B.P. is a Burroughs Wellcome Fund New Investigator in Molecular Parasitology and a member of a Canadian Institutes of Health research group (GR-14500) on host-pathogen interactions.
|
|
|---|
This article has been cited by other articles:
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Copyright © 2009 by the American Society for Microbiology. For an alternate route to Journals.ASM.org, visit: http://intl-journals.asm.org | More Info»